| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DNAM-1/CD226 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DNAM-1/CD226 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DNAM-1/CD226. This antibody reacts with human. The DNAM-1/CD226 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNA |
|---|
| Other Names | CD226 antigenplatelet and T cell activation antigen 1, CD226 molecule, DNAM1adhesion glycoprotein, DNAM-1DNAX accessory molecule-1, DNAX accessory molecule 1, PTA1, T lineage-specific activation antigen 1 antigen, TLiSA1 |
|---|
| Gene, Accession # | CD226, Gene ID: 10666 |
|---|
| Catalog # | NBP2-68690 |
|---|
| Price | |
|---|
| Order / More Info | DNAM-1/CD226 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|