| Edit |   |
|---|
| Antigenic Specificity | Kynurenine 3-Monooxygenase/KMO |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Kynurenine 3-Monooxygenase/KMO Antibody from Novus Biologicals is a rabbit polyclonal antibody to Kynurenine 3-Monooxygenase/KMO. This antibody reacts with human. The Kynurenine 3-Monooxygenase/KMO Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Kynurenine 3-Monooxygenase/KMO antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCVLLGDAAHAI |
|---|
| Other Names | kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) |
|---|
| Gene, Accession # | KMO, Gene ID: 8564 |
|---|
| Catalog # | NBP2-54915 |
|---|
| Price | |
|---|
| Order / More Info | Kynurenine 3-Monooxygenase/KMO Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|