| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | S100B |
|---|
| Clone | 2720 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein A purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The S100B Antibody (2720) from Novus Biologicals is a mouse monoclonal antibody to S100B. This antibody reacts with human, mouse, rat. The S100B Antibody (2720) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat S100B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE |
|---|
| Other Names | beta (neural), NEF, S100, S100 beta, S100 calcium binding protein B, S100 calcium-binding protein B, S100 calcium-binding protein, beta (neural), S-100 calcium-binding protein, beta chain, 10protein S100-B, S-100 protein beta chain, S-100 protein subunit beta, S100beta |
|---|
| Gene, Accession # | S100B, Gene ID: 6285, Accession: P04271 |
|---|
| Catalog # | NBP2-46626 |
|---|
| Price | |
|---|
| Order / More Info | S100B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|