| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NKp46/NCR1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NKp46/NCR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NKp46/NCR1. This antibody reacts with human. The NKp46/NCR1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human NKp46/NCR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVT |
|---|
| Other Names | CD335, CD335 antigen, hNKp46, LY94lymphocyte antigen 94 homolog (activating NK-receptor; NK-p46), Lymphocyte antigen 94 homolog, natural cytotoxicity triggering receptor 1, Natural killer cell p46-related protein, NK cell-activating receptor, NKp46, NKP46FLJ99094, NK-p46lymphocyte antigen 94 (mouse) homolog (activating NK-receptor; NK-p46) |
|---|
| Gene, Accession # | NCR1, Gene ID: 9437 |
|---|
| Catalog # | NBP2-58055 |
|---|
| Price | |
|---|
| Order / More Info | NKp46/NCR1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|