| 产品详情 |
| Edit |   |
| Antigenic Specificity | ENPP-3/CD203c |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ENPP-3/CD203c Antibody from Novus Biologicals is a rabbit polyclonal antibody to ENPP-3/CD203c. This antibody reacts with human. The ENPP-3/CD203c Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ENPP-3/CD203c antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LHYAKNVRIDKVHLFVDQQWLAVRSKSNTNCGGGNHGYNNEFRSMEAIFLAHGPSFKEKTEVEPFEN |
| Other Names | CD203c, CD203c antigen, dJ1005H11.3 (phosphodiesterase I/nucleotide pyrophosphatase 3), dJ914N13.3 (phosphodiesterase I/nucleotide pyrophosphatase 3), ectonucleotide pyrophosphatase/phosphodiesterase 3, ectonucleotide pyrophosphatase/phosphodiesterase family member 3, E-NPP 3, gp130RB13-6, NPP3, PD-IBETA, PDNP3B10, Phosphodiesterase I beta, Phosphodiesterase I/nucleotide pyrophosphatase 3, phosphodiesterase-I beta |
| Gene, Accession # | ENPP3, Gene ID: 5169 |
| Catalog # | NBP1-88928 |
| Price | |
| Order / More Info | ENPP-3/CD203c Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|