| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MAP3K12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MAP3K12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MAP3K12. This antibody reacts with human. The MAP3K12 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human MAP3K12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LLHGNTMEKLIKKRNVPQKLSPHSKRPDILKTESLLPKLDAALSGVGLPGCPKGPPSPGRSRRGKTRHRKASAKGSCGDL |
|---|
| Other Names | DLKEC 2.7.11.25, Dual leucine zipper bearing kinase, EC 2.7.11, Leucine-zipper protein kinase, MAPK-upstream kinase, MEKK12, mitogen-activated protein kinase kinase kinase 12, Mixed lineage kinase, MUKdual leucine zipper kinase DLK, protein kinase MUK, ZPKleucine zipper protein kinase, ZPKP1 |
|---|
| Gene, Accession # | MAP3K12, Gene ID: 7786 |
|---|
| Catalog # | NBP2-58000 |
|---|
| Price | |
|---|
| Order / More Info | MAP3K12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|