| Edit |   |
|---|
| Antigenic Specificity | Tubulin alpha-8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Tubulin alpha-8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Tubulin alpha-8. This antibody reacts with mouse. The Tubulin alpha-8 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to the N terminal of Tuba8. Immunizing peptide sequence ADGTFGTQASKINDDDSFTTFFSETGNGKHVPRAVMVDLEPTVVDEVRAG. |
|---|
| Other Names | Alpha-tubulin 8, TUBAL2Tubulin alpha chain-like 2, tubulin alpha-8 chain, tubulin, alpha 8 |
|---|
| Gene, Accession # | TUBA8, Gene ID: 51807, Accession: Q9JJZ2 |
|---|
| Catalog # | NBP1-74176-20ul |
|---|
| Price | |
|---|
| Order / More Info | Tubulin alpha-8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|