| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TCF-2/HNF-1 beta |
|---|
| Clone | 4A1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TCF-2/HNF-1 beta Antibody (4A1) from Novus Biologicals is a mouse monoclonal antibody to TCF-2/HNF-1 beta. This antibody reacts with human. The TCF-2/HNF-1 beta Antibody (4A1) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | TCF2 (NP_000449, 29 a.a. - 118 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDP |
|---|
| Other Names | FJHN, hepatocyte nuclear factor 1-beta, HNF1 beta A, HNF1 homeobox B, HNF-1B, HNF1beta, HNF-1-beta, HNF2, Homeoprotein LFB3, LFB3, LF-B3, MODY5HPC11, TCF-2, TCF2transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor, Transcription factor 2, transcription factor 2, hepatic, Variant hepatic nuclear factor 1, vHNF1 |
|---|
| Gene, Accession # | HNF1B, Gene ID: 6928, Accession: NP_000449, SwissProt: NP_000449 |
|---|
| Catalog # | H00006928-M07 |
|---|
| Price | |
|---|
| Order / More Info | TCF-2/HNF-1 beta Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|