| Edit |   |
| Antigenic Specificity | Melanoma Antigen Family B, 1 (MAGEB1) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. |
| Immunogen | MAGEB1 antibody was raised using the middle region of MAGEB1 corresponding to a region with amino acids EFLAKMNGATPRDFPSHYEEALRDEEERAQVRSSVRARRRTTATTFRARS |
| Other Names | MAGEB1|MAGEB4|CT3.1|DAM10|MAGE-Xp|MAGEL1|Mageb1|RGD1560904|Mage-b1|Mage-rs1|Magel1|Smage1|dam1 |
| Gene, Accession # | Gene ID: 4112 |
| Catalog # | ABIN632955 |
| Price | |
| Order / More Info | Melanoma Antigen Family B, 1 (MAGEB1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |