| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TCF-3/E2A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TCF-3/E2A Antibody from Novus Biologicals is a rabbit polyclonal antibody to TCF-3/E2A. This antibody reacts with human. The TCF-3/E2A Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TCF-3/E2A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPS |
|---|
| Other Names | BHLHB21, bHLHb21TCF-3, Class B basic helix-loop-helix protein 21, E2A immunoglobulin enhancer-binding factor E12/E47, E2AKappa-E2-binding factor, Immunoglobulin enhancer-binding factor E12/E47, Immunoglobulin transcription factor 1, ITF1Transcription factor ITF-1, MGC129647, MGC129648, Transcription factor 3, transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47), transcription factor E2-alpha, VDIR, VDR interacting repressor |
|---|
| Gene, Accession # | TCF3, Gene ID: 6929, Accession: P15923, SwissProt: P15923 |
|---|
| Catalog # | NBP2-38611 |
|---|
| Price | |
|---|
| Order / More Info | TCF-3/E2A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|