| Edit |   |
| Antigenic Specificity | MAGEA10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 43%, rat 43%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | ICC-IF |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human MAGEA10 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTST |
| Other Names | melanoma antigen family A10, CT1.10, MAGE10, MGC10599 |
| Gene, Accession # | Gene ID: 4109, UniProt: P43363, ENSG00000124260 |
| Catalog # | HPA070780 |
| Price | |
| Order / More Info | MAGEA10 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |