| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TCF19 |
|---|
| Clone | 6D8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | ascites, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, RNA Inhibition. Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TCF19 Antibody (6D8) from Novus Biologicals is a mouse monoclonal antibody to TCF19. This antibody reacts with human. The TCF19 Antibody (6D8) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, RNA Inhibition. |
|---|
| Immunogen | TCF19 (NP_009040, 17 a.a. - 102 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DLYTFHPPAGVGCTYRLGHRADLCDVALRPQQEPGLISGIHAELHAEPRGDDWRVSLEDHSSQGTLVNNVRLPRGHRLELSDGDLL |
|---|
| Other Names | SC1(TCF19)-6, SC1-1, SC1SC1(TCF19)-7, SCI(TCF19)-4, TCF-19, transcription factor 19, Transcription factor SC1 |
|---|
| Gene, Accession # | TCF19, Gene ID: 6941, Accession: NP_009040, SwissProt: NP_009040 |
|---|
| Catalog # | H00006941-M01 |
|---|
| Price | |
|---|
| Order / More Info | TCF19 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|