| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TCERG1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TCERG1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TCERG1. This antibody reacts with human. The TCERG1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TCERG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HPTPTMLSIQKWQFSMSAIKEEQELMEEINEDEPVKAKKRKRDDNKDIDSEKEAAMEAEIKAARERAIVPLE |
|---|
| Other Names | CA150TATA box-binding protein-associated factor 2S, co-activator of 150 kDa, TAF2SMGC133200, TATA box binding protein (TBP)-associated factor, RNA polymerase II, S, 150kD, TATA box-binding protein-associated factor 2S, transcription elongation regulator 1, Transcription factor CA150, Urn1 |
|---|
| Gene, Accession # | TCERG1, Gene ID: 10915 |
|---|
| Catalog # | NBP2-57767 |
|---|
| Price | |
|---|
| Order / More Info | TCERG1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|