| Edit |   |
|---|
| Antigenic Specificity | CGR19 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CGR19 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CGR19. This antibody reacts with human. The CGR19 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CGRRF1(cell growth regulator with ring finger domain 1) The peptide sequence was selected from the middle region of CGRRF1. Peptide sequence KKDSKEEIYCQLPRDTKIEDFGTVPRSRYPLVALLTLADEDDREIYDIIS. |
|---|
| Other Names | cell growth regulator with ring finger domain 1, Cell growth regulatory gene 19 protein, CGR19cell growth regulator with RING finger domain protein 1, RING finger protein 197, RNF197GCRRF1 |
|---|
| Gene, Accession # | CGRRF1, Gene ID: 10668, Accession: Q99675, SwissProt: Q99675 |
|---|
| Catalog # | NBP1-55026 |
|---|
| Price | |
|---|
| Order / More Info | CGR19 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|