| 产品详情 |
| Edit |   |
| Antigenic Specificity | C2GNT3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The C2GNT3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C2GNT3. This antibody reacts with human. The C2GNT3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human C2GNT3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VKWNYYEGFFYPSCTGSHLRSVCIYGAAELRWLIKDGHWFANKFDSKVDPILIKCLAEKLEEQQRDWITLPS |
| Other Names | beta-1,3-galactosyl-O-glycosyl-glycoproteinbeta-1,6-N-acetylglucosaminyltransferase 4, C2GNT3, core 2 beta-1,6-N-acetylglucosaminyltransferase 3, Core 2-branching enzyme 3, Core2-GlcNAc-transferase 3, EC 2.4.1.102, glucosaminyl (N-acetyl) transferase 4, core 2, glucosaminyl (N-acetyl) transferase 4, core 2(beta-1,6-N-acetylglucosaminyltransferase) |
| Gene, Accession # | GCNT4, Gene ID: 51301 |
| Catalog # | NBP1-88270 |
| Price | |
| Order / More Info | C2GNT3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|