| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CGI-16 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CGI-16 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CGI-16. This antibody reacts with human. The CGI-16 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CGI-16 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VMVARDSENKGPAFVNPLIPESPEEEELFRQGELNKGRRIAFSSTSLLKMAPSAEERTTIHEMFLSTLDPKTISFRSRVLPSNAVWME |
|---|
| Other Names | ACATE2, Acyl-CoA thioester hydrolase 9, acyl-CoA thioesterase 9acyl-Coenzyme A thioesterase 2, mitochondrial, acyl-coenzyme A thioesterase 9, mitochondrial, CGI-16, EC 3.1.2, EC 3.1.2.-, EC 3.1.2.15, mitochondrial Acyl-CoA Thioesterase, MT-ACT48 |
|---|
| Gene, Accession # | ACOT9, Gene ID: 23597 |
|---|
| Catalog # | NBP1-90275 |
|---|
| Price | |
|---|
| Order / More Info | CGI-16 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|