| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DIP13B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DIP13B Antibody from Novus Biologicals is a rabbit polyclonal antibody to DIP13B. This antibody reacts with human. The DIP13B Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DIP13B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KICYAINLGKEIIEVQKDPEALAQLMLSIPLTNDGKYVLLNDQPDDDDGN PNEHRGAESEA |
|---|
| Other Names | Adapter protein containing PH domain, PTB domain and leucine zipper motif 2, adaptor protein containing PH domain, PTB domain and leucine zipper motif 2, adaptor protein, phosphotyrosine interaction, PH domain and leucine zippercontaining 2, DCC-interacting protein 13-beta, DIP13BDIP13 beta, Dip13-beta, FLJ10659dip13-beta |
|---|
| Gene, Accession # | APPL2, Gene ID: 55198 |
|---|
| Catalog # | NBP2-14304 |
|---|
| Price | |
|---|
| Order / More Info | DIP13B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|