| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DIP2A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DIP2A Antibody from Novus Biologicals is a rabbit polyclonal antibody to DIP2A. This antibody reacts with human. The DIP2A Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DIP2A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RAKLLARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRS |
|---|
| Other Names | Dip2, DIP2 disco-interacting protein 2 homolog A (Drosophila), DIP2 homolog A, DIP2C21orf106, disco-interacting protein 2 homolog A, disco-interacting protein 2A, KIAA0184chromosome 21 open reading frame 106 |
|---|
| Gene, Accession # | DIP2A, Gene ID: 23181, Accession: Q14689, SwissProt: Q14689 |
|---|
| Catalog # | NBP2-30966 |
|---|
| Price | |
|---|
| Order / More Info | DIP2A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|