| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NCOA4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NCOA4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NCOA4. This antibody reacts with human. The NCOA4 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human NCOA4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQ |
|---|
| Other Names | Androgen receptor coactivator 70 kDa protein, Androgen receptor-associated protein of 70 kDa, ARA70RFGret fused, DKFZp762E1112, ELE1NCoA-4, nuclear receptor coactivator 4,70 kDa AR-activator, PTC3RET-activating gene ELE1, Ret-activating protein ELE1,70 kDa androgen receptor coactivator |
|---|
| Gene, Accession # | NCOA4, Gene ID: 8031, Accession: Q13772, SwissProt: Q13772 |
|---|
| Catalog # | NBP2-39048 |
|---|
| Price | |
|---|
| Order / More Info | NCOA4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|