| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NCKIPSD |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NCKIPSD Antibody from Novus Biologicals is a rabbit polyclonal antibody to NCKIPSD. This antibody reacts with human. The NCKIPSD Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human NCKIPSD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RKETLSRRGPSASSVAVMTSSTSDHHLDAAAARQPNGVCRAGFERQHSLPSSEHLGADGGLYQIPLPSSQIPPQP |
|---|
| Other Names | 54 kDa vimentin-interacting protein, 90 kDa SH3 protein interacting with Nck, AF3p21, AF3P21DIP-1, dia interacting protein, Dia-interacting protein 1, diaphanous protein interacting protein, Diaphanous protein-interacting protein, DIP, DIP1, MGC23891, NCK interacting protein with SH3 domain, ORF1, SPIN90VIP54, WASLBP, WASP-interacting SH3-domain protein, WISHSH3 adapter protein SPIN90, Wisk90 kDa |
|---|
| Gene, Accession # | NCKIPSD, Gene ID: 51517 |
|---|
| Catalog # | NBP2-56886 |
|---|
| Price | |
|---|
| Order / More Info | NCKIPSD Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|