Edit |   |
Antigenic Specificity | Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS). |
Immunogen | GPD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGP |
Other Names | CG9042|DROGPDHA|DmG3PDH|Dmel\\CG9042|G3PDH|G3pdh|GAPDH|GPD|GPDA|GPDH|GPDH-1|Gdh|Gpd|alpha-GPD|alpha-GPDH|alpha-GPDH-1|alpha-Gpdh|alphaGPDH|alphaGpd|alphaGpdh|alphaGpdh-1|gpdh|gpdh-1|sn-Gpdh|gpd1|MGC79676|GPD1|GPD-C|GPDH-C|LG3P|HTGTI|AI747587|Gdc-1|Gdc1|mKIAA4010|Gpd3|wu:fc30a07|zgc:63859 |
Gene, Accession # | Gene ID: 2819 |
Catalog # | ABIN631716 |
Price | |
Order / More Info | Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |