| 产品详情 |
| Edit |   |
| Antigenic Specificity | ENT2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ENT2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ENT2. This antibody reacts with human. The ENT2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ENT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KFARYYLANKSSQAQAQELETKAELLQSDENGIPSSPQKVALTLDLDLEKEPESEPDEPQKPGKPSVFTVFQK |
| Other Names | Delayed-early response protein 12, DER12Solute carrier family 29 member 2, ENT2, Equilibrative NBMPR-insensitive nucleoside transporter, Equilibrative nitrobenzylmercaptopurine riboside-insensitive nucleosidetransporter, equilibrative nucleoside transporter 2, HNP3636 kDa nucleolar protein HNP36, Hydrophobic nucleolar protein, 36 kDa, hydrophobic nucleolar protein, 36kD, Nucleoside transporter, ei-type, solute carrier family 29 (nucleoside transporters), member 2 |
| Gene, Accession # | SLC29A2, Gene ID: 3177 |
| Catalog # | NBP1-85253 |
| Price | |
| Order / More Info | ENT2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|