| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NCAPH2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NCAPH2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NCAPH2. This antibody reacts with human. The NCAPH2 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human NCAPH2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AAKLQDFHQWYLAAYADHADSRRLRRKGPSFADMEVLYWTHVKEQLETLRKLQRREVAEQWLRPAEEDHLEDSLEDLGAADDFLEPEEYMEPEG |
|---|
| Other Names | CAP-H2, CAP-H2 subunit of the condensin II complex, CAPH2,384D8-2, Chromosome-associated protein H2, condensin-2 complex subunit H2, hCAP-H2, kleisin beta, Kleisin-beta, MGC15858, MGC18000, MGC2455, MGC4133, MGC5305, MGC8640, Non-SMC condensin II complex subunit H2, non-SMC condensin II complex, subunit H2 |
|---|
| Gene, Accession # | NCAPH2, Gene ID: 29781 |
|---|
| Catalog # | NBP2-57498 |
|---|
| Price | |
|---|
| Order / More Info | NCAPH2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|