| Edit |   |
| Antigenic Specificity | LURAP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LURAP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LURAP1. This antibody reacts with human. The LURAP1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to NF-kappaB activator C1orf190 The peptide sequence was selected from the middle region of NF-kappaB activator C1orf190. Peptide sequence SIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRL. |
| Other Names | chromosome 1 open reading frame 190, FLJ25163, hypothetical protein LOC541468, NF-kappaB activator C1orf190 |
| Gene, Accession # | LURAP1, Gene ID: 541468, Accession: Q96LR2, SwissProt: Q96LR2 |
| Catalog # | NBP1-56823-20ul |
| Price | |
| Order / More Info | LURAP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |