| Edit |   |
|---|
| Antigenic Specificity | KLF14 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KLF14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KLF14. This antibody reacts with human. The KLF14 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human KLF14. Peptide sequence SAAVACLDYFAAECLVSMSAGAVVHRRPPDPEGAGGAAGSEVGAAHPESA. |
|---|
| Other Names | basic transcription element-binding protein 5, Kruppel-like factor 14 |
|---|
| Gene, Accession # | KLF14, Gene ID: 136259, Accession: NP_619638, SwissProt: NP_619638 |
|---|
| Catalog # | NBP1-80141 |
|---|
| Price | |
|---|
| Order / More Info | KLF14 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|