| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KLF12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KLF12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KLF12. This antibody reacts with human. The KLF12 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human KLF12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDMEAVPLLLNNVKGEPPEDSLSVDHFQTQTEPVDLSIN |
|---|
| Other Names | AP-2rep, AP-2rep transcription factor, AP2REPAP-2 repressor, HSPC122, KLF12 zinc finger transcriptional repressor, Krueppel-like factor 12, Kruppel-like factor 12, Transcriptional repressor AP-2rep |
|---|
| Gene, Accession # | KLF12, Gene ID: 11278 |
|---|
| Catalog # | NBP2-56075 |
|---|
| Price | |
|---|
| Order / More Info | KLF12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|