| Edit |   |
|---|
| Antigenic Specificity | BBSome Interacting Protein 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BBSome Interacting Protein 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BBSome Interacting Protein 1. This antibody reacts with human. The BBSome Interacting Protein 1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human BBSome Interacting Protein 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EVKSMFREVLPKQGPLFVEDIMTMVLCKPKLLPLKSLTLEKLEKMHQAAQNTIRQQEMAEKDQRQ |
|---|
| Other Names | bA348N5.3, BBIP1, BBIP10, BBSome-Interacting Protein 1, BBSome-Interacting Protein Of 10 KDa, NCRNA00081, Non-Protein Coding RNA 81, UPF0604 Protein |
|---|
| Gene, Accession # | BBIP1, Gene ID: 92482, Accession: A8MTZ0, SwissProt: A8MTZ0 |
|---|
| Catalog # | NBP2-30510 |
|---|
| Price | |
|---|
| Order / More Info | BBSome Interacting Protein 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|