| Edit |   |
|---|
| Antigenic Specificity | Protocadherin-8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Protocadherin-8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Protocadherin-8. This antibody reacts with human. The Protocadherin-8 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PCDH8(protocadherin 8) The peptide sequence was selected from the middle region of PCDH8. Peptide sequence GATSLVPEGAARESLVALVSTSDRDSGANGQVRCALYGHEHFRLQPAYAG. |
|---|
| Other Names | ARCADLIN, PAPC, protocadherin 8, protocadherin-8 |
|---|
| Gene, Accession # | PCDH8, Gene ID: 5100, Accession: Q5TAN1, SwissProt: Q5TAN1 |
|---|
| Catalog # | NBP1-59272-20ul |
|---|
| Price | |
|---|
| Order / More Info | Protocadherin-8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|