| Edit |   |
|---|
| Antigenic Specificity | Protocadherin-8 |
|---|
| Clone | 1C5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. It has been used for ELISA and WB. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Protocadherin-8 Antibody (1C5) from Novus Biologicals is a mouse monoclonal antibody to Protocadherin-8. This antibody reacts with human. The Protocadherin-8 Antibody (1C5) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | PCDH8 (NP_002581, 32 a.a. - 120 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VRYSTFEEDAPGTVIGTLAEDLHMKVSGDTSFRLMKQFNSSLLRVREGDGQLTVGDAGLDRERLCGQAPQCVLAFDVVSFSQEQFRLVH |
|---|
| Other Names | ARCADLIN, PAPC, protocadherin 8, protocadherin-8 |
|---|
| Gene, Accession # | PCDH8, Gene ID: 5100, Accession: NP_002581, SwissProt: NP_002581 |
|---|
| Catalog # | H00005100-M02 |
|---|
| Price | |
|---|
| Order / More Info | Protocadherin-8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|