| Edit |   |
|---|
| Antigenic Specificity | Protocadherin-18 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Protocadherin-18 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Protocadherin-18. This antibody reacts with human. The Protocadherin-18 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human PCDH18The immunogen for this antibody is PCDH18. Peptide sequence MHQMNAKMHFRFVFALLIVSFNHDVLGKNLKYRIYEEQRVGSVIARLSED. |
|---|
| Other Names | protocadherin 18 |
|---|
| Gene, Accession # | PCDH18, Gene ID: 54510, Accession: NP_061908, SwissProt: NP_061908 |
|---|
| Catalog # | NBP1-79315 |
|---|
| Price | |
|---|
| Order / More Info | Protocadherin-18 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|