| Edit |   |
| Antigenic Specificity | Protocadherin-18 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Protocadherin-18 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Protocadherin-18. This antibody reacts with human. The Protocadherin-18 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human PCDH18The immunogen for this antibody is PCDH18. Peptide sequence MHQMNAKMHFRFVFALLIVSFNHDVLGKNLKYRIYEEQRVGSVIARLSED. |
| Other Names | protocadherin 18 |
| Gene, Accession # | PCDH18, Gene ID: 54510, Accession: NP_061908, SwissProt: NP_061908 |
| Catalog # | NBP1-79315-20ul |
| Price | |
| Order / More Info | Protocadherin-18 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |