| Edit |   |
|---|
| Antigenic Specificity | Protocadherin-17 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Protocadherin-17 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Protocadherin-17. This antibody reacts with human. The Protocadherin-17 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PCDH17(protocadherin 17) The peptide sequence was selected from the C terminal of PCDH17. Peptide sequence SEMGAVLEQLDHPNRDLGRESVDAEEVVREIDKLLQDCRGNDPVAVRK. |
|---|
| Other Names | PCDH68protocadherin-68, PCH68Protocadherin-68, protocadherin 17, protocadherin 68, protocadherin-17 |
|---|
| Gene, Accession # | PCDH17, Gene ID: 27253, Accession: O14917, SwissProt: O14917 |
|---|
| Catalog # | NBP1-54818 |
|---|
| Price | |
|---|
| Order / More Info | Protocadherin-17 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|