| Edit |   |
|---|
| Antigenic Specificity | Protocadherin-15 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Protocadherin-15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Protocadherin-15. This antibody reacts with human. The Protocadherin-15 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PCDH15(protocadherin 15) The peptide sequence was selected from the N terminal of PCDH15. Peptide sequence HSIVVQVQCINKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTP. |
|---|
| Other Names | autosomal recessive 23, cadherin-related family member 15, DKFZp667A1711, protocadherin-15, protocadherin-related 15 |
|---|
| Gene, Accession # | PCDH15, Gene ID: 65217, Accession: A2A3E5, SwissProt: A2A3E5 |
|---|
| Catalog # | NBP1-60065 |
|---|
| Price | |
|---|
| Order / More Info | Protocadherin-15 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|