| Edit |   |
|---|
| Antigenic Specificity | IP6K3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IP6K3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IP6K3. This antibody reacts with human. The IP6K3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human IP6K3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QRFYESLPLAMKRFTPQYKGTVTVHLWKDSTGHLSLVANPVKESQEPFKVSTESAAVAIWQTLQQTTGSNGSDCTLAQWPHAQL |
|---|
| Other Names | IHPK3ATP:1D-myo-inositol-hexakisphosphate phosphotransferase, inositol hexakisphosphate kinase 3, Inositol hexaphosphate kinase 3EC 2.7.4.21, InsP6 kinase 3, INSP6K3MGC102928 |
|---|
| Gene, Accession # | IP6K3, Gene ID: 117283, Accession: Q96PC2, SwissProt: Q96PC2 |
|---|
| Catalog # | NBP2-33689 |
|---|
| Price | |
|---|
| Order / More Info | IP6K3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|