| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AGPAT6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AGPAT6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AGPAT6. This antibody reacts with human. The AGPAT6 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human AGPAT6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FAWATLRMERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSSKALDNTPEFELSDIFYFCRKGMETIMDDEVTKRFSAEELESW |
|---|
| Other Names | 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acidacyltransferase, zeta), Acyl-CoA:glycerol-3-phosphate acyltransferase 4, DKFZp586M1819,1-acyl-sn-glycerol-3-phosphate acyltransferase zeta, EC 2.3.1.15, glycerol-3-phosphate acyltransferase 4,1-AGP acyltransferase 6, glycerol-3-phosphate acyltransferase 6,1-AGPAT 6, GPAT4,1-acylglycerol-3-phosphate O-acyltransferase 6, LPAAT-zetaLPAATZ, Lysophosphatidic acid acyltransferase zeta, testis spermatogenesis apoptosis-related protein 7, TSARG7 |
|---|
| Gene, Accession # | AGPAT6, Gene ID: 137964 |
|---|
| Catalog # | NBP1-85061 |
|---|
| Price | |
|---|
| Order / More Info | AGPAT6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|