| Edit |   |
| Antigenic Specificity | Involucrin |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 25ul |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Involucrin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Involucrin. This antibody reacts with human. The Involucrin Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QQHTLPVTLSPALSQELLKTVPPPVNTHQEQMKQPTPLPPPCQKVPVELPVEVPSKQEEKHMTAVKGLPEQECEQ |
| Other Names | involucrin |
| Gene, Accession # | IVL, Gene ID: 3713, Accession: P07476, SwissProt: P07476 |
| Catalog # | NBP2-33742-25ul |
| Price | |
| Order / More Info | Involucrin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |