| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Twist-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. WB: Use at a concentration of 2.5 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Twist-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Twist-1. This antibody reacts with human, rat. The Twist-1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity: TWIST1 |
|---|
| Immunogen | A synthetic peptide corresponding to a region of human TWIST1 with an internal ID of P20171. Peptide sequence DKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVW. |
|---|
| Other Names | acrocephalosyndactyly 3, ACS3, B-HLH DNA binding protein, BHLHA38, bHLHa38BPES3, Class A basic helix-loop-helix protein 38, CRS1, H-twistblepharophimosis, epicanthus inversus and ptosis 3, SCSBPES2, TWIST, twist homolog 1 (Drosophila), TWIST homolog of drosophila, twist-related protein 1 |
|---|
| Gene, Accession # | TWIST1, Gene ID: 7291 |
|---|
| Catalog # | NB120-49254 |
|---|
| Price | |
|---|
| Order / More Info | Twist-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26825317 |
|---|
| 产品资料 |
|
|