| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TWF2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TWF2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TWF2. This antibody reacts with human. The TWF2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TWF2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HQTGIHATEELKEFFAKARAGSVRLIKVVIEDEQLVLGASQEPVGRWDQDYDRAVLPLLDAQQPCYLLYR |
|---|
| Other Names | A6-related protein, A6RPFLJ56277, hA6RP, Protein tyrosine kinase 9-like, protein tyrosine kinase 9-like (A6-related protein), PTK9L protein tyrosine kinase 9-like (A6-related protein), PTK9LA6r, twinfilin, actin-binding protein, homolog 2 (Drosophila), Twinfilin-1-like protein, twinfilin-2 |
|---|
| Gene, Accession # | TWF2, Gene ID: 11344 |
|---|
| Catalog # | NBP2-47591 |
|---|
| Price | |
|---|
| Order / More Info | TWF2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|