| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TWEAK/TNFSF12 |
|---|
| Clone | 4H3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TWEAK/TNFSF12 Antibody (4H3) from Novus Biologicals is a mouse monoclonal antibody to TWEAK/TNFSF12. This antibody reacts with human, mouse. The TWEAK/TNFSF12 Antibody (4H3) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | TNFSF12 (AAH19047, 49 a.a. - 134 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQADGGYTTCLRP |
|---|
| Other Names | APO3 ligand, APO3LMGC20669, DR3LGTWEAKAPO3/DR3 ligand, MGC129581, TNF-related weak inducer of apoptosis, tumor necrosis factor (ligand) superfamily, member 12, tumor necrosis factor ligand superfamily member 12 |
|---|
| Gene, Accession # | TNFSF12, Gene ID: 8742, Accession: AAH19047, SwissProt: AAH19047 |
|---|
| Catalog # | H00008742-M01 |
|---|
| Price | |
|---|
| Order / More Info | TWEAK/TNFSF12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|