| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Phospholipase A2 XII |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Phospholipase A2 XII Antibody from Novus Biologicals is a rabbit polyclonal antibody to Phospholipase A2 XII. This antibody reacts with human. The Phospholipase A2 XII Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Phospholipase A2 XII antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHY |
|---|
| Other Names | EC 3.1.1.4, group XII secreted phospholipase A2, group XIIA secreted phospholipase A2, group XIIA secretory phospholipase A2, GXII, GXII sPLA2, Phosphatidylcholine 2-acylhydrolase 12A, phospholipase A2, group XII, phospholipase A2, group XIIA, PLA2G12, ROSSY, sPLA2-XII |
|---|
| Gene, Accession # | PLA2G12A, Gene ID: 81579 |
|---|
| Catalog # | NBP1-87265 |
|---|
| Price | |
|---|
| Order / More Info | Phospholipase A2 XII Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|