| Edit |   |
|---|
| Antigenic Specificity | Phospholipase A2 IIE |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Phospholipase A2 IIE Antibody from Novus Biologicals is a rabbit polyclonal antibody to Phospholipase A2 IIE. This antibody reacts with human. The Phospholipase A2 IIE Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human PLA2G2E. Peptide sequence GIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPP. |
|---|
| Other Names | GIIE sPLA2, group IIE secretory phospholipase A2, phospholipase A2, group IIE |
|---|
| Gene, Accession # | PLA2G2E, Gene ID: 30814, Accession: NP_055404, SwissProt: NP_055404 |
|---|
| Catalog # | NBP1-79199 |
|---|
| Price | |
|---|
| Order / More Info | Phospholipase A2 IIE Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|