| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Fas Ligand/TNFSF6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Fas Ligand/TNFSF6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Fas Ligand/TNFSF6. This antibody reacts with human. The Fas Ligand/TNFSF6 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Fas Ligand/TNFSF6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFV |
|---|
| Other Names | apoptosis (APO-1) antigen ligand 1, Apoptosis antigen ligand, APT1LG1CD95L, APTL, CD178, CD178 antigen, CD95-L, Fas antigen ligand, Fas ligand, Fas ligand (TNF superfamily, member 6), FASLCD95 ligand, TNFSF6FasL, tumor necrosis factor (ligand) superfamily, member 6, tumor necrosis factor ligand superfamily member 6 |
|---|
| Gene, Accession # | FASLG, Gene ID: 356 |
|---|
| Catalog # | NBP2-49160 |
|---|
| Price | |
|---|
| Order / More Info | Fas Ligand/TNFSF6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|