| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC34A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC34A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC34A1. This antibody reacts with human, mouse, rat. The SLC34A1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SLC34A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PLPVPGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEHTCPC GEVLERHEPLPAKLALEEEQKPESRLVPKLRQA |
|---|
| Other Names | FRTS2, Na(+)/Pi cotransporter 2A, Na(+)-dependent phosphate cotransporter 2A, NaPi-2a, NaPi-3, NPT2NPHLOP1, NPTIIa, renal sodium-dependent phosphate transporter, SLC11, SLC17A2Na+-phosphate cotransporter type II, sodium/phosphate co-transporter, Sodium/phosphate cotransporter 2A, sodium-dependent phosphate transport protein 2A, Sodium-phosphate transport protein 2A, solute carrier family 17 (sodium phosphate), member 2, solute carrier family 34 (sodium phosphate), member 1, Solute carrier family 34 member 1 |
|---|
| Gene, Accession # | SLC34A1, Gene ID: 6569 |
|---|
| Catalog # | NBP2-13328 |
|---|
| Price | |
|---|
| Order / More Info | SLC34A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25790436, 26751835, 28233855, 28341272 |
|---|
| 产品资料 |
|
|