| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC30A5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC30A5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC30A5. This antibody reacts with human. The SLC30A5 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SLC30A5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SSPSKRGQKGTLIGYSPEGTPLYNFMGDAFQHSSQSIPRFIKESLKQILEESDSRQ |
|---|
| Other Names | FLJ12756, MGC5499, solute carrier family 30 (zinc transporter), member 5, zinc transporter 5, zinc transporter ZTL1, ZnT-5FLJ12496, ZNT5Solute carrier family 30 member 5, ZNTL1hZTL1, ZTL1ZnT-like transporter 1 |
|---|
| Gene, Accession # | SLC30A5, Gene ID: 64924 |
|---|
| Catalog # | NBP1-82299 |
|---|
| Price | |
|---|
| Order / More Info | SLC30A5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|