| 产品详情 |
| Edit |   |
| Antigenic Specificity | SLC2A7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SLC2A7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC2A7. This antibody reacts with human. The SLC2A7 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SLC2A7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SVVNTPHKVFKSFYNETYFERHATFMDGKLM |
| Other Names | GLUT-7, GLUT7Glucose transporter type 7, intestinal facilitative glucose transporter 7, solute carrier family 2 (facilitated glucose transporter), member 7, solute carrier family 2, facilitated glucose transporter member 7 |
| Gene, Accession # | SLC2A7, Gene ID: 155184 |
| Catalog # | NBP1-81821 |
| Price | |
| Order / More Info | SLC2A7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 29548810 |
| 产品资料 |
|
|