| Edit |   |
|---|
| Antigenic Specificity | PAOX |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PAOX Antibody from Novus Biologicals is a rabbit polyclonal antibody to PAOX. This antibody reacts with human. The PAOX Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PAOX(polyamine oxidase (exo-N4-amino)) The peptide sequence was selected from the middle region of PAOX. Peptide sequence RGSAVGMEGGRPPPQSVGPAGAAAQAQALAGPSLLCSTRVGGRLGPSFLL. |
|---|
| Other Names | DKFZp434J245, MGC45464, PAO, polyamine oxidase, polyamine oxidase (exo-N4-amino) |
|---|
| Gene, Accession # | PAOX, Gene ID: 196743, Accession: Q6QHF9, SwissProt: Q6QHF9 |
|---|
| Catalog # | NBP1-70667-20ul |
|---|
| Price | |
|---|
| Order / More Info | PAOX Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|