| Edit |   |
|---|
| Antigenic Specificity | CHCHD6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CHCHD6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CHCHD6. This antibody reacts with human. The CHCHD6 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human CHCHD6The immunogen for this antibody is CHCHD6. Peptide sequence LPRSGSSGGQQPSGMKEGVKRYEQEHAAIQDKLFQVAKREREAATKHSKA. |
|---|
| Other Names | coiled-coil-helix-coiled-coil-helix domain containing 6, coiled-coil-helix-coiled-coil-helix domain-containing protein 6, MGC13016 |
|---|
| Gene, Accession # | CHCHD6, Gene ID: 84303, Accession: NP_115719, SwissProt: NP_115719 |
|---|
| Catalog # | NBP1-79819-20ul |
|---|
| Price | |
|---|
| Order / More Info | CHCHD6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|