| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GilZ |
|---|
| Clone | 3A5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin. Antibody reactivity against recombinant protein for WB. It has been used for IHC-P, IF and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GilZ Antibody (3A5) from Novus Biologicals is a mouse monoclonal antibody to GilZ. This antibody reacts with human. The GilZ Antibody (3A5) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | TSC22D3 (NP_932174, 1 a.a. - 97 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQT |
|---|
| Other Names | Delta sleep-inducing peptide immunoreactor, DSIP-immunoreactive leucine zipper protein, DSIP-immunoreactive peptide, GILZDKFZp313A1123, Glucocorticoid-induced leucine zipper protein, Protein DIP, TSC22 domain family protein 3, TSC22 domain family, member 3, TSC-22 related protein, TSC-22-like protein, TSC-22-related protein, TSC-22Rimmunoreactor |
|---|
| Gene, Accession # | TSC22D3, Gene ID: 1831, Accession: NP_932174, SwissProt: NP_932174 |
|---|
| Catalog # | H00001831-M01 |
|---|
| Price | |
|---|
| Order / More Info | GilZ Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|