| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GilZ |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GilZ Antibody from Novus Biologicals is a rabbit polyclonal antibody to GilZ. This antibody reacts with human. The GilZ Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human GilZ antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQTMLSILLFFH |
|---|
| Other Names | Delta sleep-inducing peptide immunoreactor, DSIP-immunoreactive leucine zipper protein, DSIP-immunoreactive peptide, GILZDKFZp313A1123, Glucocorticoid-induced leucine zipper protein, Protein DIP, TSC22 domain family protein 3, TSC22 domain family, member 3, TSC-22 related protein, TSC-22-like protein, TSC-22-related protein, TSC-22Rimmunoreactor |
|---|
| Gene, Accession # | TSC22D3, Gene ID: 1831 |
|---|
| Catalog # | NBP2-55645 |
|---|
| Price | |
|---|
| Order / More Info | GilZ Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|