| Edit |   |
| Antigenic Specificity | Gigaxonin |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Gigaxonin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Gigaxonin. This antibody reacts with human. The Gigaxonin Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to GAN(gigaxonin) The peptide sequence was selected from the middle region of GAN. Peptide sequence IYLNDQNLCIPASSSFVYGAVPIGASIYVIGDLDTGTNYDYVREFKRSTG. |
| Other Names | FLJ38059, GAN1KLHL16Kelch-like protein 16, giant axonal neuropathy (gigaxonin), gigaxonin |
| Gene, Accession # | GAN, Gene ID: 8139, Accession: Q9H2C0, SwissProt: Q9H2C0 |
| Catalog # | NBP1-57821-20ul |
| Price | |
| Order / More Info | Gigaxonin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |